PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15440A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 339aa    MW: 36714.4 Da    PI: 4.5434
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15440AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-184794148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT eEd llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Oropetium_20150105_15440A 47 RGPWTVEEDVLLVNYIASHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 94
                               89********************************************97 PP

2Myb_DNA-binding52.89.3e-17100143146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_15440A 100 RGNITAEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 143
                                7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2454294IPR017930Myb domain
SuperFamilySSF466896.79E-3145141IPR009057Homeodomain-like
SMARTSM007173.0E-154696IPR001005SANT/Myb domain
PfamPF002491.9E-164794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2248101IPR009057Homeodomain-like
CDDcd001671.79E-124994No hitNo description
PROSITE profilePS5129423.79395149IPR017930Myb domain
SMARTSM007173.3E-1599147IPR001005SANT/Myb domain
PfamPF002492.1E-15100143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-23102147IPR009057Homeodomain-like
CDDcd001671.75E-12104143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEIAAAPGMV GSSDDQQLEE VMLGTMSPAG SAVSAAGSED DEGDLRRGPW TVEEDVLLVN  60
YIASHGEGRW NSLARSAGLK RTGKSCRLRW LNYLRPDVRR GNITAEEQLL ILELHSRWGN  120
RWSKIAQHLP GRTDNEIKNY WRTRVQKHAR QLRCDVNSKQ FRDVVRYVWM PRLVERIQAG  180
ESSAAAAAAD DHDKTTATAS APAACQMSAY GGGGAPANND AHQEYLVDCY SEPGQTTAAA  240
MSPEDASSAV RSSLTTEANN PLASTTTTPS NGQCGGTTAE PVDSEDMMAQ AEDVFGGSWS  300
DLLAATGRDD TMPGFEFGDF EDNLWSLEDL CLHHQQCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26441471103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387361e-132BT038736.1 Zea mays full-length cDNA clone ZM_BFb0316K16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700181.11e-127PREDICTED: transcriptional activator Myb
TrEMBLK3Z7F41e-127K3Z7F4_SETIT; Uncharacterized protein
STRINGSi022474m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-83myb domain protein 112